MSX1 (NM_002448) Human Mass Spec Standard

CAT#: PH305682

MSX1 MS Standard C13 and N15-labeled recombinant protein (NP_002439)

Product Images

Coomassie blue staining of purified MSX1 protein (Cat# TP305682). The protein was produced from HEK293T cells transfected with MSX1 cDNA clone (Cat# RC205682) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205682
• Predicted MW: 31.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205682 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADH
  RKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKP
  ERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLS
  LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQR
  AALPVAPVGLYTAHVGYSMYHLT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002439
• RefSeq Size: 1940
• RefSeq ORF: 909
• Synonyms: ECTD3; HOX7; HYD1; STHAG1
• Locus ID: 4487
• UniProt ID: P28360
• Cytogenetics: 4p16.2
• Summary: 'This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transcription Factors