PPP1R14A (NM_033256) Human Mass Spec Standard

CAT#: PH305799

PPP1R14A MS Standard C13 and N15-labeled recombinant protein (NP_150281)

Product Images

Coomassie blue staining of purified PPP1R14A protein (Cat# TP305799). The protein was produced from HEK293T cells transfected with PPP1R14A cDNA clone (Cat# RC205799) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205799
• Predicted MW: 16.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205799 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEAD
  MPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQD
  RARTAHP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_150281
• RefSeq Size: 782
• RefSeq ORF: 441
• Synonyms: CPI-17; CPI17; PPP1INL
• Locus ID: 94274
• UniProt ID: Q96A00
• Cytogenetics: 19q13.2
• Summary: The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads to increased myosin phosphorylation and enhanced smooth muscle contraction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Vascular smooth muscle contraction