PPP1R14A (NM_033256) Human Recombinant Protein

CAT#: TP305799

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14A (PPP1R14A)

Product Images

Coomassie blue staining of purified PPP1R14A protein (Cat# TP305799). The protein was produced from HEK293T cells transfected with PPP1R14A cDNA clone (Cat# RC205799) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205799 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEAD
  MPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQD
  RARTAHP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_150281
• Locus ID: 94274
• UniProt ID: Q96A00
• Cytogenetics: 19q13.2
• Refseq Size: 782
• Refseq ORF: 441
• Synonyms: CPI-17; CPI17; PPP1INL
• Summary: The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads to increased myosin phosphorylation and enhanced smooth muscle contraction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Vascular smooth muscle contraction