WSB1 (NM_015626) Human Mass Spec Standard

CAT#: PH305839

WSB1 MS Standard C13 and N15-labeled recombinant protein (NP_056441)

Product Images

Coomassie blue staining of purified WSB1 protein (Cat# TP305839). The protein was produced from HEK293T cells transfected with WSB1 cDNA clone (Cat# RC205839) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205839
• Predicted MW: 47.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205839 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNF
  LLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQ
  LLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVL
  RGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV
  YIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP
  LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYR
  I
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056441
• RefSeq Size: 2849
• RefSeq ORF: 1263
• Synonyms: SWIP1; WSB-1
• Locus ID: 26118
• UniProt ID: Q9Y6I7, A0A024QZ51, Q8NC76
• Cytogenetics: 17q11.1
• Summary: This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome