DBPA (YBX3) (NM_003651) Human Mass Spec Standard

CAT#: PH305856

CSDA MS Standard C13 and N15-labeled recombinant protein (NP_003642)

Product Images

Coomassie blue staining of purified YBX3 protein (Cat# TP305856). The protein was produced from HEK293T cells transfected with YBX3 cDNA clone (Cat# RC205856) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205856
• Predicted MW: 40.1 kDa
• Protein Sequence:
  Sequence Link

  >RC205856 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAA
  ASLAAAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGET
  VEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPP
  ATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGP
  VHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGK
  EAKAGEAPTENPAPPTQQSSAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003642
• RefSeq Size: 1976
• RefSeq ORF: 1116
• Synonyms: CSDA; CSDA1; DBPA; ZONAB
• Locus ID: 8531
• UniProt ID: P16989, A0A024RAQ1
• Cytogenetics: 12p13.2
• Protein Families: Transcription Factors
• Protein Pathways: Tight junction