DBPA (YBX3) (NM_003651) Human Recombinant Protein
CAT#: TP305856
Recombinant protein of human cold shock domain protein A (CSDA), transcript variant 1
View other "YBX3" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205856 protein sequence
Red=Cloning site Green=Tags(s) MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAA ASLAAAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGET VEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPP ATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGP VHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGK EAKAGEAPTENPAPPTQQSSAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003642 |
Locus ID | 8531 |
UniProt ID | P16989, A0A024RAQ1 |
Cytogenetics | 12p13.2 |
Refseq Size | 1976 |
Refseq ORF | 1116 |
Synonyms | CSDA; CSDA1; DBPA; ZONAB |
Summary | Binds to the GM-CSF promoter. Seems to act as a repressor. Binds also to full-length mRNA and to short RNA sequences containing the consensus site 5'-UCCAUCA-3'. May have a role in translation repression (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Protein Pathways | Tight junction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401208 | YBX3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401208 | Transient overexpression lysate of cold shock domain protein A (CSDA), transcript variant 1 |
USD 396.00 |
|
PH305856 | CSDA MS Standard C13 and N15-labeled recombinant protein (NP_003642) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review