IFI30 (NM_006332) Human Mass Spec Standard

CAT#: PH305877

IFI30 MS Standard C13 and N15-labeled recombinant protein (NP_006323)

Product Images

Coomassie blue staining of purified IFI30 protein (Cat# TP305877). The protein was produced from HEK293T cells transfected with IFI30 cDNA clone (Cat# RC205877) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205877
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC205877 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA
  LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME
  LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV
  NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006323
• RefSeq Size: 1034
• RefSeq ORF: 750
• Synonyms: GILT; IFI-30; IP-30; IP30
• Locus ID: 10437
• UniProt ID: P13284, A0A024R7N7
• Cytogenetics: 19p13.11
• Summary: The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq, Jul 2008]
• Protein Pathways: Antigen processing and presentation