IFI30 (NM_006332) Human Recombinant Protein

CAT#: TP305877

Purified recombinant protein of Homo sapiens interferon, gamma-inducible protein 30 (IFI30)

Product Images

Coomassie blue staining of purified IFI30 protein (Cat# TP305877). The protein was produced from HEK293T cells transfected with IFI30 cDNA clone (Cat# RC205877) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205877 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA
  LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME
  LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV
  NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006323
• Locus ID: 10437
• UniProt ID: P13284, A0A024R7N7
• Cytogenetics: 19p13.11
• Refseq Size: 1034
• Refseq ORF: 750
• Synonyms: GILT; IFI-30; IP-30; IP30
• Summary: The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq, Jul 2008]
• Protein Pathways: Antigen processing and presentation