RBP5 (NM_031491) Human Mass Spec Standard

CAT#: PH305891

RBP5 MS Standard C13 and N15-labeled recombinant protein (NP_113679)

Product Images

Coomassie blue staining of purified RBP5 protein (Cat# TP305891). The protein was produced from HEK293T cells transfected with RBP5 cDNA clone (Cat# RC205891) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205891
• Predicted MW: 15.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205891 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVE
  FEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_113679
• RefSeq Size: 968
• RefSeq ORF: 405
• Synonyms: CRBP-III; CRBP3; CRBPIII; HRBPiso
• Locus ID: 83758
• UniProt ID: P82980
• Cytogenetics: 12p13.31
• Summary: The protein encoded by this gene is a cellular retinol-binding protein expressed highly in kidney and liver. Down-regulation of the encoded protein in hepatocellular carcinoma was associated with large tumor size and poor patient survival rates. [provided by RefSeq, Jul 2016]