RBP5 (NM_031491) Human Recombinant Protein

CAT#: TP305891

Recombinant protein of human retinol binding protein 5, cellular (RBP5)

Product Images

Coomassie blue staining of purified RBP5 protein (Cat# TP305891). The protein was produced from HEK293T cells transfected with RBP5 cDNA clone (Cat# RC205891) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205891 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVE
  FEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_113679
• Locus ID: 83758
• UniProt ID: P82980
• Cytogenetics: 12p13.31
• Refseq Size: 968
• Refseq ORF: 405
• Synonyms: CRBP-III; CRBP3; CRBPIII; HRBPiso
• Summary: The protein encoded by this gene is a cellular retinol-binding protein expressed highly in kidney and liver. Down-regulation of the encoded protein in hepatocellular carcinoma was associated with large tumor size and poor patient survival rates. [provided by RefSeq, Jul 2016]