Myosin Light Chain 2 (MYL2) (NM_000432) Human Mass Spec Standard

CAT#: PH305932

MYL2 MS Standard C13 and N15-labeled recombinant protein (NP_000423)

Product Images

Coomassie blue staining of purified MYL2 protein (Cat# TP305932). The protein was produced from HEK293T cells transfected with MYL2 cDNA clone (Cat# RC205932) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205932
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC205932 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI
  KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA
  AFPPDVTGNLDYKNLVHIITHGEEKD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000423
• RefSeq Size: 855
• RefSeq ORF: 498
• Synonyms: CMH10; MLC-2s/v; MLC2
• Locus ID: 4633
• UniProt ID: P10916, Q6IB42
• Cytogenetics: 12q24.11
• Summary: 'Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction