Myosin Light Chain 2 (MYL2) (NM_000432) Human Recombinant Protein

CAT#: TP305932

Recombinant protein of human myosin, light chain 2, regulatory, cardiac, slow (MYL2)

Product Images

Coomassie blue staining of purified MYL2 protein (Cat# TP305932). The protein was produced from HEK293T cells transfected with MYL2 cDNA clone (Cat# RC205932) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205932 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI
  KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA
  AFPPDVTGNLDYKNLVHIITHGEEKD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000423
• Locus ID: 4633
• UniProt ID: P10916, Q6IB42
• Cytogenetics: 12q24.11
• Refseq Size: 855
• Refseq ORF: 498
• Synonyms: CMH10; MLC-2s/v; MLC2
• Summary: Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]
• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction