ERp57 (PDIA3) (NM_005313) Human Mass Spec Standard

CAT#: PH305940

PDIA3 MS Standard C13 and N15-labeled recombinant protein (NP_005304)

Product Images

Coomassie blue staining of purified PDIA3 protein (Cat# TP305940). The protein was produced from HEK293T cells transfected with PDIA3 cDNA clone (Cat# RC205940) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205940
• Predicted MW: 56.78 kDa
• Protein Sequence:
  Sequence Link

  >RC205940 representing NM_005313
  Red=Cloning site Green=Tags(s)
  
  MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAA
  ATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR
  TEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSH
  LTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR
  NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE
  RFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
  EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVI
  QEEKPKKKKKAQEDL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005304
• RefSeq Size: 3060
• RefSeq ORF: 1515
• Synonyms: ER60; ERp57; ERp60; ERp61; GRP57; GRP58; HEL-S-93n; HEL-S-269; HsT17083; P58; PI-PLC
• Locus ID: 2923
• UniProt ID: P30101, V9HVY3
• Cytogenetics: 15q15.3
• Summary: 'This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates. [provided by RefSeq, Dec 2016]'
• Protein Families: Druggable Genome
• Protein Pathways: Antigen processing and presentation