HSD17B11 (NM_016245) Human Mass Spec Standard

CAT#: PH305941

HSD17B11 MS Standard C13 and N15-labeled recombinant protein (NP_057329)

Product Images

Coomassie blue staining of purified HSD17B11 protein (Cat# TP305941). The protein was produced from HEK293T cells transfected with HSD17B11 cDNA clone (Cat# RC205941) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205941
• Predicted MW: 32.8 kDa
• Protein Sequence:
  Sequence Link

  >RC205941 representing NM_016245
  Red=Cloning site Green=Tags(s)
  
  MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK
  HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT
  FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG
  VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV
  LKRKISVKFDAVIGYKMKAQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057329
• RefSeq Size: 1701
• RefSeq ORF: 900
• Synonyms: 17-BETA-HSD11; 17-BETA-HSDXI; 17BHSD11; DHRS8; PAN1B; RETSDR2; SDR16C2
• Locus ID: 51170
• UniProt ID: Q8NBQ5
• Cytogenetics: 4q22.1
• Summary: Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]). [supplied by OMIM, Jun 2009]
• Protein Families: Druggable Genome, Secreted Protein