FATE1 (NM_033085) Human Mass Spec Standard

CAT#: PH305951

FATE1 MS Standard C13 and N15-labeled recombinant protein (NP_149076)

Product Images

Coomassie blue staining of purified FATE1 protein (Cat# TP305951). The protein was produced from HEK293T cells transfected with FATE1 cDNA clone (Cat# RC205951) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205951
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205951 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM
  TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ
  LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_149076
• RefSeq Size: 1071
• RefSeq ORF: 549
• Synonyms: CT43; FATE
• Locus ID: 89885
• UniProt ID: Q969F0
• Cytogenetics: Xq28
• Summary: This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation. [provided by RefSeq, Jan 2010]
• Protein Families: Transmembrane