FATE1 (NM_033085) Human Recombinant Protein
CAT#: TP305951
Recombinant protein of human fetal and adult testis expressed 1 (FATE1)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205951 protein sequence
Red=Cloning site Green=Tags(s) MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.5 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_149076 |
| Locus ID | 89885 |
| UniProt ID | Q969F0 |
| Cytogenetics | Xq28 |
| Refseq Size | 1071 |
| Refseq ORF | 549 |
| Synonyms | CT43; FATE |
| Summary | This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation. [provided by RefSeq, Jan 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409735 | FATE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY409735 | Transient overexpression lysate of fetal and adult testis expressed 1 (FATE1) |
USD 436.00 |
|
| PH305951 | FATE1 MS Standard C13 and N15-labeled recombinant protein (NP_149076) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China