CTRP5 (C1QTNF5) (NM_015645) Human Mass Spec Standard

CAT#: PH305968

C1QTNF5 MS Standard C13 and N15-labeled recombinant protein (NP_056460)

Product Images

Coomassie blue staining of purified C1QTNF5 protein (Cat# TP305968). The protein was produced from HEK293T cells transfected with C1QTNF5 cDNA clone (Cat# RC205968) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205968
• Predicted MW: 25.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205968 representing NM_015645
  Red=Cloning site Green=Tags(s)
  
  MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGR
  PGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVT
  GKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVG
  VGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056460
• RefSeq Size: 3927
• RefSeq ORF: 729
• Synonyms: CTRP5; MFRP
• Locus ID: 114902
• UniProt ID: Q9BXJ0, A0A024R3F8
• Cytogenetics: 11q23.3
• Summary: This gene encodes a member of a family of proteins that function as components of basement membranes and may play a role in cell adhesion. Mutations in this gene have been associated with late-onset retinal degeneration. The protein may be encoded by either a bicistronic transcript including sequence from the upstream membrane frizzled-related protein gene (MFRP), or by a monocistronic transcript expressed from an internal promoter. [provided by RefSeq, Jun 2013]
• Protein Families: Secreted Protein