CTRP5 (C1QTNF5) (NM_015645) Human Recombinant Protein

CAT#: TP305968

Purified recombinant protein of Homo sapiens C1q and tumor necrosis factor related protein 5 (C1QTNF5)

Product Images

Coomassie blue staining of purified C1QTNF5 protein (Cat# TP305968). The protein was produced from HEK293T cells transfected with C1QTNF5 cDNA clone (Cat# RC205968) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205968 representing NM_015645
  Red=Cloning site Green=Tags(s)
  
  MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGR
  PGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVT
  GKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVG
  VGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056460
• Locus ID: 114902
• UniProt ID: Q9BXJ0, A0A024R3F8
• Cytogenetics: 11q23.3
• Refseq Size: 3927
• Refseq ORF: 729
• Synonyms: CTRP5; MFRP
• Summary: This gene encodes a member of a family of proteins that function as components of basement membranes and may play a role in cell adhesion. Mutations in this gene have been associated with late-onset retinal degeneration. The protein may be encoded by either a bicistronic transcript including sequence from the upstream membrane frizzled-related protein gene (MFRP), or by a monocistronic transcript expressed from an internal promoter. [provided by RefSeq, Jun 2013]
• Protein Families: Secreted Protein