Nudel (NDEL1) (NM_030808) Human Mass Spec Standard

CAT#: PH305974

NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_110435)

Product Images

Coomassie blue staining of purified NDEL1 protein (Cat# TP305974). The protein was produced from HEK293T cells transfected with NDEL1 cDNA clone (Cat# RC205974) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205974
• Predicted MW: 38.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205974 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ
  RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE
  QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV
  QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ
  ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGFDTAPPPPGLGSSRPSSAPGMLPLSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_110435
• RefSeq Size: 2407
• RefSeq ORF: 1035
• Synonyms: EOPA; MITAP1; NDE1L1; NDE2; NUDEL
• Locus ID: 81565
• UniProt ID: Q9GZM8
• Cytogenetics: 17p13.1
• Summary: This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Mar 2012]