Nudel (NDEL1) (NM_001025579) Human Mass Spec Standard
CAT#: PH312323
NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_001020750)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212323 |
Predicted MW | 36.9 kDa |
Protein Sequence |
>RC212323 representing NM_001025579
Red=Cloning site Green=Tags(s) MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGQEKVIFPTLFMGQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001020750 |
RefSeq Size | 2420 |
RefSeq ORF | 984 |
Synonyms | EOPA; MITAP1; NDE1L1; NDE2; NUDEL |
Locus ID | 81565 |
UniProt ID | Q9GZM8 |
Cytogenetics | 17p13.1 |
Summary | This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Mar 2012] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410703 | NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422448 | NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410703 | Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2 |
USD 396.00 |
|
LY422448 | Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1 |
USD 396.00 |
|
PH305974 | NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_110435) |
USD 2,055.00 |
|
TP305974 | Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2 |
USD 823.00 |
|
TP312323 | Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review