PIP4K2C (NM_024779) Human Mass Spec Standard
CAT#: PH305976
PIP4K2C MS Standard C13 and N15-labeled recombinant protein (NP_079055)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205976 |
Predicted MW | 47.3 kDa |
Protein Sequence |
>RC205976 protein sequence
Red=Cloning site Green=Tags(s) MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR LPVHRKYDLKGSLVSREASDKEKVKELPTLRDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF A myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079055 |
RefSeq Size | 3229 |
RefSeq ORF | 1263 |
Synonyms | PIP5K2C |
Locus ID | 79837 |
UniProt ID | Q8TBX8 |
Cytogenetics | 12q13.3 |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411069 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431328 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431351 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431365 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411069 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 1 |
USD 396.00 |
|
LY431328 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 4 |
USD 396.00 |
|
LY431351 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 3 |
USD 396.00 |
|
LY431365 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2 |
USD 396.00 |
|
TP305976 | Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C) |
USD 823.00 |
|
TP328337 | Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review