MTAP (NM_002451) Human Mass Spec Standard

CAT#: PH306024

MTAP MS Standard C13 and N15-labeled recombinant protein (NP_002442)

Product Images

Coomassie blue staining of purified MTAP protein (Cat# TP306024). The protein was produced from HEK293T cells transfected with MTAP cDNA clone (Cat# RC206024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206024
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC206024 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPS
  KVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPM
  AEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGI
  CYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLL
  PRH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002442
• RefSeq Size: 4937
• RefSeq ORF: 849
• Synonyms: BDMF; c86fus; DMSFH; DMSMFH; HEL-249; LGMBF; MSAP
• Locus ID: 4507
• UniProt ID: Q13126, A0A384ME80
• Cytogenetics: 9p21.3
• Summary: 'This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways