MTAP (NM_002451) Human Recombinant Protein

CAT#: TP306024

Recombinant protein of human methylthioadenosine phosphorylase (MTAP)

Product Images

Coomassie blue staining of purified MTAP protein (Cat# TP306024). The protein was produced from HEK293T cells transfected with MTAP cDNA clone (Cat# RC206024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206024 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPS
  KVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPM
  AEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGI
  CYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLL
  PRH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002442
• Locus ID: 4507
• UniProt ID: Q13126, A0A384ME80
• Cytogenetics: 9p21.3
• Refseq Size: 4937
• Refseq ORF: 849
• Synonyms: BDMF; c86fus; DMSFH; DMSMFH; HEL-249; LGMBF; MSAP
• Summary: This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways