LTC4S (NM_145867) Human Mass Spec Standard

CAT#: PH306062

LTC4S MS Standard C13 and N15-labeled recombinant protein (NP_665874)

Product Images

Coomassie blue staining of purified LTC4S protein (Cat# TP306062). The protein was produced from HEK293T cells transfected with LTC4S cDNA clone (Cat# RC206062) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206062
• Predicted MW: 16.5 kDa
• Protein Sequence:
  Sequence Link

  >RC206062 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA
  GIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALL
  GQLRTLLPWA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_665874
• RefSeq Size: 680
• RefSeq ORF: 450
• Synonyms: MGC33147
• Locus ID: 4056
• UniProt ID: Q16873
• Cytogenetics: 5q35.3
• Summary: 'The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways