LTC4S (NM_145867) Human Recombinant Protein
CAT#: TP306062
Recombinant protein of human leukotriene C4 synthase (LTC4S)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206062 protein sequence
Red=Cloning site Green=Tags(s) MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA GIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALL GQLRTLLPWA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.4 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | Enzyme activity (PMID: 27791009) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_665874 |
| Locus ID | 4056 |
| UniProt ID | Q16873 |
| Cytogenetics | 5q35.3 |
| Refseq Size | 680 |
| Refseq ORF | 450 |
| Summary | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407849 | LTC4S HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY407849 | Transient overexpression lysate of leukotriene C4 synthase (LTC4S) |
USD 436.00 |
|
| PH306062 | LTC4S MS Standard C13 and N15-labeled recombinant protein (NP_665874) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China