EGLN2 (NM_053046) Human Mass Spec Standard
CAT#: PH306152
EGLN2 MS Standard C13 and N15-labeled recombinant protein (NP_444274)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206152 |
| Predicted MW | 43.7 kDa |
| Protein Sequence |
>RC206152 protein sequence
Red=Cloning site Green=Tags(s) MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_444274 |
| RefSeq Size | 2264 |
| RefSeq ORF | 1221 |
| Synonyms | EIT-6; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1 |
| Locus ID | 112398 |
| UniProt ID | Q96KS0, A0A024R0R2 |
| Cytogenetics | 19q13.2 |
| Summary | The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403281 | EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC409048 | EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403281 | Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1 |
USD 436.00 |
|
| LY409048 | Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3 |
USD 436.00 |
|
| TP306152 | Recombinant protein of human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1 |
USD 823.00 |
|
| TP760370 | Purified recombinant protein of Human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China