EGLN2 (NM_053046) Human Mass Spec Standard

CAT#: PH306152

EGLN2 MS Standard C13 and N15-labeled recombinant protein (NP_444274)

Product Images

Coomassie blue staining of purified EGLN2 protein (Cat# TP306152). The protein was produced from HEK293T cells transfected with EGLN2 cDNA clone (Cat# RC206152) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206152
• Predicted MW: 43.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206152 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS
  TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE
  NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV
  EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT
  KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF
  WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_444274
• RefSeq Size: 2264
• RefSeq ORF: 1221
• Synonyms: EIT-6; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1
• Locus ID: 112398
• UniProt ID: Q96KS0, A0A024R0R2
• Cytogenetics: 19q13.2
• Summary: The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. [provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Pathways in cancer, Renal cell carcinoma