EGLN2 (NM_053046) Human Recombinant Protein

CAT#: TP306152

Recombinant protein of human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1

Product Images

Coomassie blue staining of purified EGLN2 protein (Cat# TP306152). The protein was produced from HEK293T cells transfected with EGLN2 cDNA clone (Cat# RC206152) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206152 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS
  TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE
  NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV
  EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT
  KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF
  WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Enzyme activity (In vitro hydroxylation assay) (PMID: 26751287)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444274
• Locus ID: 112398
• UniProt ID: Q96KS0, A0A024R0R2
• Cytogenetics: 19q13.2
• Refseq Size: 2264
• Refseq ORF: 1221
• Synonyms: EIT-6; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1
• Summary: The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. [provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Pathways in cancer, Renal cell carcinoma