ARF3 (NM_001659) Human Mass Spec Standard

CAT#: PH306192

ARF3 MS Standard C13 and N15-labeled recombinant protein (NP_001650)

Product Images

Coomassie blue staining of purified ARF3 protein (Cat# TP306192). The protein was produced from HEK293T cells transfected with ARF3 cDNA clone (Cat# RC206192) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206192
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Sequence Link

  >RC206192 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG
  QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT
  DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001650
• RefSeq Size: 3556
• RefSeq ORF: 543
• Synonyms: ADP-ribosylation factor 3; ADP-ribosylation factor protein 3; small GTP binding protein
• Locus ID: 377
• UniProt ID: P61204, A0A024R0Y6
• Cytogenetics: 12q13.12
• Summary: 'ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns. [provided by RefSeq, Jul 2008]'