ARF3 (NM_001659) Human Recombinant Protein

CAT#: TP306192

Recombinant protein of human ADP-ribosylation factor 3 (ARF3)

Product Images

Coomassie blue staining of purified ARF3 protein (Cat# TP306192). The protein was produced from HEK293T cells transfected with ARF3 cDNA clone (Cat# RC206192) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206192 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG
  QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT
  DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001650
• Locus ID: 377
• UniProt ID: P61204, A0A024R0Y6
• Cytogenetics: 12q13.12
• Refseq Size: 3556
• Refseq ORF: 543
• Summary: ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns. [provided by RefSeq, Jul 2008]