C10orf82 (NM_144661) Human Mass Spec Standard

CAT#: PH306202

C10orf82 MS Standard C13 and N15-labeled recombinant protein (NP_653262)

Product Images

Coomassie blue staining of purified C10orf82 protein (Cat# TP306202). The protein was produced from HEK293T cells transfected with C10orf82 cDNA clone (Cat# RC206202) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206202
• Predicted MW: 17.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206202 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVN
  SEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEI
  TERAKKAHLKPYEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653262
• RefSeq Size: 1009
• RefSeq ORF: 462
• Synonyms: FLJ40268; MGC33547
• Locus ID: 143379
• UniProt ID: Q8WW14
• Cytogenetics: 10q25.3