C10orf82 (NM_144661) Human Recombinant Protein

CAT#: TP306202

Recombinant protein of human chromosome 10 open reading frame 82 (C10orf82)

Product Images

Coomassie blue staining of purified C10orf82 protein (Cat# TP306202). The protein was produced from HEK293T cells transfected with C10orf82 cDNA clone (Cat# RC206202) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206202 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVN
  SEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEI
  TERAKKAHLKPYEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_653262
• Locus ID: 143379
• UniProt ID: Q8WW14
• Cytogenetics: 10q25.3
• Refseq Size: 1009
• Refseq ORF: 462