ECRG4 (NM_032411) Human Mass Spec Standard

CAT#: PH306239

C2orf40 MS Standard C13 and N15-labeled recombinant protein (NP_115787)

Product Images

Coomassie blue staining of purified ECRG4 protein (Cat# TP306239). The protein was produced from HEK293T cells transfected with ECRG4 cDNA clone (Cat# RC206239) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206239
• Predicted MW: 17.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206239 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKR
  QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHG
  ASVNYDDY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115787
• RefSeq Size: 793
• RefSeq ORF: 444
• Synonyms: C2orf40
• Locus ID: 84417
• UniProt ID: Q9H1Z8
• Cytogenetics: 2q12.2
• Summary: Probable hormone that may induce senescence of oligodendrocyte and neural precursor cells, characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation. [UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane