Centrin 1 (CETN1) (NM_004066) Human Mass Spec Standard

CAT#: PH306285

CETN1 MS Standard C13 and N15-labeled recombinant protein (NP_004057)

Product Images

Coomassie blue staining of purified CETN1 protein (Cat# TP306285). The protein was produced from HEK293T cells transfected with CETN1 cDNA clone (Cat# RC206285) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206285
• Predicted MW: 19.6 kDa
• Protein Sequence:
  Sequence Link

  >RC206285 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMK
  KMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDE
  ELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004057
• RefSeq Size: 1161
• RefSeq ORF: 516
• Synonyms: CEN1; CETN
• Locus ID: 1068
• UniProt ID: Q12798, A0A140VJG3
• Cytogenetics: 18p11.32
• Summary: 'The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jan 2015]'
• Protein Families: Druggable Genome