Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein
CAT#: TP306285
Recombinant protein of human centrin, EF-hand protein, 1 (CETN1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206285 protein sequence
Red=Cloning site Green=Tags(s) MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMK KMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDE ELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004057 |
Locus ID | 1068 |
UniProt ID | Q12798, A0A140VJG3 |
Cytogenetics | 18p11.32 |
Refseq Size | 1161 |
Refseq ORF | 516 |
Synonyms | CEN1; CETN |
Summary | The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401316 | CETN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401316 | Transient overexpression lysate of centrin, EF-hand protein, 1 (CETN1) |
USD 396.00 |
|
PH306285 | CETN1 MS Standard C13 and N15-labeled recombinant protein (NP_004057) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review