Ceramide glucosyltransferase (UGCG) (NM_003358) Human Mass Spec Standard

CAT#: PH306288

UGCG MS Standard C13 and N15-labeled recombinant protein (NP_003349)

Product Images

Coomassie blue staining of purified UGCG protein (Cat# TP306288). The protein was produced from HEK293T cells transfected with UGCG cDNA clone (Cat# RC206288) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206288
• Predicted MW: 44.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206288 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL
  ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI
  WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTG
  MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLR
  INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA
  VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003349
• RefSeq Size: 1637
• RefSeq ORF: 1182
• Synonyms: GCS; GLCT1
• Locus ID: 7357
• UniProt ID: Q16739, A0A024R157
• Cytogenetics: 9q31.3
• Summary: 'This gene encodes an enzyme that catalyzes the first glycosylation step in the biosynthesis of glycosphingolipids, which are membrane components containing lipid and sugar moieties. The product of this reaction is glucosylceramide, which is the core structure of many glycosphingolipids. [provided by RefSeq, Dec 2014]'
• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism