Ceramide glucosyltransferase (UGCG) (NM_003358) Human Recombinant Protein

CAT#: TP306288

Recombinant protein of human UDP-glucose ceramide glucosyltransferase (UGCG)

Product Images

Coomassie blue staining of purified UGCG protein (Cat# TP306288). The protein was produced from HEK293T cells transfected with UGCG cDNA clone (Cat# RC206288) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206288 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL
  ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI
  WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTG
  MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLR
  INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA
  VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003349
• Locus ID: 7357
• UniProt ID: Q16739, A0A024R157
• Cytogenetics: 9q31.3
• Refseq Size: 1637
• Refseq ORF: 1182
• Synonyms: GCS; GLCT1
• Summary: This gene encodes an enzyme that catalyzes the first glycosylation step in the biosynthesis of glycosphingolipids, which are membrane components containing lipid and sugar moieties. The product of this reaction is glucosylceramide, which is the core structure of many glycosphingolipids. [provided by RefSeq, Dec 2014]
• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism