ACBD7 (NM_001039844) Human Mass Spec Standard

CAT#: PH306332

ACBD7 MS Standard C13 and N15-labeled recombinant protein (NP_001034933)

Product Images

Coomassie blue staining of purified ACBD7 protein (Cat# TP306332). The protein was produced from HEK293T cells transfected with ACBD7 cDNA clone (Cat# RC206332) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206332
• Predicted MW: 9.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206332 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED
  ATSAYISKAKELIEKYGI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001034933
• RefSeq Size: 3383
• RefSeq ORF: 264
• Synonyms: bA455B2.2
• Locus ID: 414149
• UniProt ID: Q8N6N7
• Cytogenetics: 10p13
• Summary: Binds medium- and long-chain acyl-CoA esters. [UniProtKB/Swiss-Prot Function]