ACBD7 (NM_001039844) Human Recombinant Protein
CAT#: TP306332
Recombinant protein of human acyl-Coenzyme A binding domain containing 7 (ACBD7)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206332 protein sequence
Red=Cloning site Green=Tags(s) MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED ATSAYISKAKELIEKYGI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034933 |
Locus ID | 414149 |
UniProt ID | Q8N6N7 |
Cytogenetics | 10p13 |
Refseq Size | 3383 |
Refseq ORF | 264 |
Synonyms | bA455B2.2 |
Summary | Binds medium- and long-chain acyl-CoA esters.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421837 | ACBD7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY421837 | Transient overexpression lysate of acyl-Coenzyme A binding domain containing 7 (ACBD7) |
USD 325.00 |
|
PH306332 | ACBD7 MS Standard C13 and N15-labeled recombinant protein (NP_001034933) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review