ACBD7 (NM_001039844) Human Recombinant Protein

CAT#: TP306332

Recombinant protein of human acyl-Coenzyme A binding domain containing 7 (ACBD7)

Product Images

Coomassie blue staining of purified ACBD7 protein (Cat# TP306332). The protein was produced from HEK293T cells transfected with ACBD7 cDNA clone (Cat# RC206332) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206332 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED
  ATSAYISKAKELIEKYGI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034933
• Locus ID: 414149
• UniProt ID: Q8N6N7
• Cytogenetics: 10p13
• Refseq Size: 3383
• Refseq ORF: 264
• Synonyms: bA455B2.2
• Summary: Binds medium- and long-chain acyl-CoA esters.[UniProtKB/Swiss-Prot Function]