GTL3B (NATD1) (NM_152914) Human Mass Spec Standard

CAT#: PH306333

C17orf103 MS Standard C13 and N15-labeled recombinant protein (NP_690878)

Product Images

Coomassie blue staining of purified NATD1 protein (Cat# TP306333). The protein was produced from HEK293T cells transfected with NATD1 cDNA clone (Cat# RC206333) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206333
• Predicted MW: 13 kDa
• Protein Sequence:
  Sequence Link

  >RC206333 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYSGRGIA
  KHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_690878
• RefSeq Size: 4787
• RefSeq ORF: 339
• Synonyms: C17orf103; Gtlf3b
• Locus ID: 256302
• UniProt ID: Q8N6N6
• Cytogenetics: 17p11.2