GTL3B (NATD1) (NM_152914) Human Recombinant Protein
CAT#: TP306333
Recombinant protein of human chromosome 17 open reading frame 103 (C17orf103)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206333 protein sequence
Red=Cloning site Green=Tags(s) MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYSGRGIA KHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_690878 |
Locus ID | 256302 |
UniProt ID | Q8N6N6 |
Cytogenetics | 17p11.2 |
Refseq Size | 4787 |
Refseq ORF | 339 |
Synonyms | C17orf103; Gtlf3b |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407212 | NATD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407212 | Transient overexpression lysate of chromosome 17 open reading frame 103 (C17orf103) |
USD 396.00 |
|
PH306333 | C17orf103 MS Standard C13 and N15-labeled recombinant protein (NP_690878) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review