JMJD5 (KDM8) (NM_024773) Human Mass Spec Standard

CAT#: PH306417

JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_079049)

Product Images

Coomassie blue staining of purified KDM8 protein (Cat# TP306417). The protein was produced from HEK293T cells transfected with KDM8 cDNA clone (Cat# RC206417) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206417
• Predicted MW: 47.3 kDa
• Protein Sequence:
  Sequence Link

  >RC206417 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEV
  ILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLK
  VAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKG
  VADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFD
  QIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY
  PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079049
• RefSeq Size: 2481
• RefSeq ORF: 1248
• Synonyms: JMJD5
• Locus ID: 79831
• UniProt ID: Q8N371, A0A0S2Z5T1
• Cytogenetics: 16p12.1
• Summary: This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]