MYL7 (NM_021223) Human Mass Spec Standard

CAT#: PH306449

MYL7 MS Standard C13 and N15-labeled recombinant protein (NP_067046)

Product Images

Coomassie blue staining of purified MYL7 protein (Cat# TP306449). The protein was produced from HEK293T cells transfected with MYL7 cDNA clone (Cat# RC206449) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206449
• Predicted MW: 19.4 kDa
• Protein Sequence:
  Sequence Link

  >RC206449 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVP
  EEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSP
  AEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067046
• RefSeq Size: 619
• RefSeq ORF: 525
• Synonyms: MYL2A; MYLC2A
• Locus ID: 58498
• UniProt ID: Q01449
• Cytogenetics: 7p13
• Protein Families: Druggable Genome
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction