MYL7 (NM_021223) Human Recombinant Protein
CAT#: TP306449
Recombinant protein of human myosin, light chain 7, regulatory (MYL7)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206449 protein sequence
Red=Cloning site Green=Tags(s) MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVP EEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSP AEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067046 |
Locus ID | 58498 |
UniProt ID | Q01449 |
Cytogenetics | 7p13 |
Refseq Size | 619 |
Refseq ORF | 525 |
Synonyms | MYL2A; MYLC2A |
Protein Families | Druggable Genome |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412006 | MYL7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412006 | Transient overexpression lysate of myosin, light chain 7, regulatory (MYL7) |
USD 325.00 |
|
PH306449 | MYL7 MS Standard C13 and N15-labeled recombinant protein (NP_067046) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review