MYL7 (NM_021223) Human Recombinant Protein

CAT#: TP306449

Recombinant protein of human myosin, light chain 7, regulatory (MYL7)


  View other "MYL7" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


MYL7 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
    • 100 ul

USD 379.00

Other products for "MYL7"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC206449 protein sequence
Red=Cloning site Green=Tags(s)

MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVP
EEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSP
AEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19.3 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067046
Locus ID 58498
UniProt ID Q01449
Cytogenetics 7p13
Refseq Size 619
Refseq ORF 525
Synonyms MYL2A; MYLC2A
Protein Families Druggable Genome
Protein Pathways Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.