ALKBH1 (NM_006020) Human Mass Spec Standard

CAT#: PH306529

ALKBH1 MS Standard C13 and N15-labeled recombinant protein (NP_006011)

Product Images

Coomassie blue staining of purified ALKBH1 protein (Cat# TP306529). The protein was produced from HEK293T cells transfected with ALKBH1 cDNA clone (Cat# RC206529) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206529
• Predicted MW: 43.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206529 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVS
  SVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEET
  QDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFE
  DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSG
  FSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD
  QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006011
• RefSeq Size: 2585
• RefSeq ORF: 1167
• Synonyms: ABH; ABH1; alkB; ALKBH; hABH
• Locus ID: 8846
• UniProt ID: Q13686, Q5XKL0
• Cytogenetics: 14q24.3
• Summary: This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq, Jul 2008]