ALKBH1 (NM_006020) Human Recombinant Protein

CAT#: TP306529

Recombinant protein of human alkB, alkylation repair homolog 1 (E. coli) (ALKBH1)

Product Images

Coomassie blue staining of purified ALKBH1 protein (Cat# TP306529). The protein was produced from HEK293T cells transfected with ALKBH1 cDNA clone (Cat# RC206529) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206529 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVS
  SVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEET
  QDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFE
  DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSG
  FSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD
  QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006011
• Locus ID: 8846
• UniProt ID: Q13686, Q5XKL0
• Cytogenetics: 14q24.3
• Refseq Size: 2585
• Refseq ORF: 1167
• Synonyms: ABH; ABH1; alkB; ALKBH; hABH
• Summary: This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq, Jul 2008]