ALKBH1 (NM_006020) Human Recombinant Protein
CAT#: TP306529
Recombinant protein of human alkB, alkylation repair homolog 1 (E. coli) (ALKBH1)
View other "ALKBH1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206529 protein sequence
Red=Cloning site Green=Tags(s) MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVS SVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEET QDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFE DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSG FSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006011 |
Locus ID | 8846 |
UniProt ID | Q13686, Q5XKL0 |
Cytogenetics | 14q24.3 |
Refseq Size | 2585 |
Refseq ORF | 1167 |
Synonyms | ABH; ABH1; alkB; ALKBH; hABH |
Summary | This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401825 | ALKBH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401825 | Transient overexpression lysate of alkB, alkylation repair homolog 1 (E. coli) (ALKBH1) |
USD 396.00 |
|
PH306529 | ALKBH1 MS Standard C13 and N15-labeled recombinant protein (NP_006011) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review