Fibromodulin (FMOD) (NM_002023) Human Mass Spec Standard

CAT#: PH306534

FMOD MS Standard C13 and N15-labeled recombinant protein (NP_002014)

Product Images

Coomassie blue staining of purified FMOD protein (Cat# TP306534). The protein was produced from HEK293T cells transfected with FMOD cDNA clone (Cat# RC206534) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206534
• Predicted MW: 43.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206534 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSP
  PDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQ
  ITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHN
  EIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSL
  TNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRL
  DGNEIKRSAMPADAPLCLRLASLIEI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002014
• RefSeq Size: 3271
• RefSeq ORF: 1128
• Synonyms: FM; SLRR2E
• Locus ID: 2331
• UniProt ID: Q06828, A0A024R971, Q12833, B3KS64
• Cytogenetics: 1q32.1
• Summary: 'Fibromodulin belongs to the family of small interstitial proteoglycans. The encoded protein possesses a central region containing leucine-rich repeats with 4 keratan sulfate chains, flanked by terminal domains containing disulphide bonds. Owing to the interaction with type I and type II collagen fibrils and in vitro inhibition of fibrillogenesis, the encoded protein may play a role in the assembly of extracellular matrix. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Sequence variations in this gene may be associated with the pathogenesis of high myopia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]'
• Protein Families: Druggable Genome, Secreted Protein