PDE1B (NM_000924) Human Mass Spec Standard

CAT#: PH306588

PDE1B MS Standard C13 and N15-labeled recombinant protein (NP_000915)

Product Images

Coomassie blue staining of purified PDE1B protein (Cat# TP306588). The protein was produced from HEK293T cells transfected with PDE1B cDNA clone (Cat# RC206588) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206588
• Predicted MW: 61.4 kDa
• Protein Sequence:
  Sequence Link

  >RC206588 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAV
  YIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR
  RTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDA
  LETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKS
  ECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTAL
  QQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
  QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQ
  ENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000915
• RefSeq Size: 3463
• RefSeq ORF: 1608
• Synonyms: HEL-S-79p; PDE1B1; PDES1B
• Locus ID: 5153
• UniProt ID: Q01064, A0A024RB59
• Cytogenetics: 12q13.2
• Summary: 'The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]'
• Protein Families: Druggable Genome
• Protein Pathways: Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism