PDE1B (NM_000924) Human Recombinant Protein

CAT#: TP306588

Recombinant protein of human phosphodiesterase 1B, calmodulin-dependent (PDE1B)

Product Images

Coomassie blue staining of purified PDE1B protein (Cat# TP306588). The protein was produced from HEK293T cells transfected with PDE1B cDNA clone (Cat# RC206588) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206588 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAV
  YIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR
  RTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDA
  LETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKS
  ECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTAL
  QQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
  QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQ
  ENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 61.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000915
• Locus ID: 5153
• UniProt ID: Q01064, A0A024RB59
• Cytogenetics: 12q13.2
• Refseq Size: 3463
• Refseq ORF: 1608
• Synonyms: HEL-S-79p; PDE1B1; PDES1B
• Summary: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism