GCAP1 (GUCA1A) (NM_000409) Human Mass Spec Standard

CAT#: PH306595

GUCA1A MS Standard C13 and N15-labeled recombinant protein (NP_000400)

Product Images

Coomassie blue staining of purified GUCA1A protein (Cat# TP306595). The protein was produced from HEK293T cells transfected with GUCA1A cDNA clone (Cat# RC206595) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206595
• Predicted MW: 22.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206595 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY
  IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVF
  SKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000400
• RefSeq Size: 1918
• RefSeq ORF: 603
• Synonyms: GUCA1A; GUCA1ANB-GUCA1A
• Locus ID: 2978
• UniProt ID: P43080
• Cytogenetics: 6p21.1
• Summary: 'This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. provided by RefSeq, Jul 2020]'
• Protein Families: Druggable Genome
• Protein Pathways: Olfactory transduction