GCAP1 (GUCA1A) (NM_000409) Human Recombinant Protein

CAT#: TP306595

Recombinant protein of human guanylate cyclase activator 1A (retina) (GUCA1A)

Product Images

Coomassie blue staining of purified GUCA1A protein (Cat# TP306595). The protein was produced from HEK293T cells transfected with GUCA1A cDNA clone (Cat# RC206595) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206595 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY
  IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVF
  SKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000400
• Locus ID: 2978
• UniProt ID: P43080
• Cytogenetics: 6p21.1
• Refseq Size: 1918
• Refseq ORF: 603
• Synonyms: GUCA1A; GUCA1ANB-GUCA1A
• Summary: This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. provided by RefSeq, Jul 2020]
• Protein Families: Druggable Genome
• Protein Pathways: Olfactory transduction